Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit a (atpB)

This Recombinant Pseudomonas putida ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B1JFU7

Expression Region

1-289

Origin

Pseudomonas putida (strain W619)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAFHLDTLGWSVALGLIFL FIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLVPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEDNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Enterobacteria phage fd Virion export protein (IV), partial
MBS7062550 Inquire

Recombinant Enterobacteria phage fd Virion export protein (IV), partial

Sign In for Pricing
View Details
Recombinant Human Girdin (CCDC88A), partial
CSB-EP666322HU-01 10 µg

Recombinant Human Girdin (CCDC88A), partial

Sign In for Pricing
View Details
Recombinant Human Girdin (CCDC88A), partial
CSB-EP666322HU-02 50 µg

Recombinant Human Girdin (CCDC88A), partial

Sign In for Pricing
View Details
Recombinant Human Girdin (CCDC88A), partial
CSB-EP666322HU-03 200 µg

Recombinant Human Girdin (CCDC88A), partial

Sign In for Pricing
View Details
Recombinant Human Girdin (CCDC88A), partial
CSB-EP666322HU-04 500 µg

Recombinant Human Girdin (CCDC88A), partial

Sign In for Pricing
View Details
Recombinant Human Girdin (CCDC88A), partial
CSB-EP666322HU-05 20 µg

Recombinant Human Girdin (CCDC88A), partial

Sign In for Pricing
View Details