Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative neuropeptide Y receptor type 6 (NPY6R)

This Recombinant Human Putative neuropeptide Y receptor type 6 (NPY6R) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Putative neuropeptide Y receptor type 6, NPY6-R, NPY Y1-like receptor, Putative pancreatic polypeptide receptor 2, PP2

UniProt

Q99463

Expression Region

1-290

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIII FKKQRKAQNFTSILIANLSLSDTLVCVMCIHFTIIYTLMDHWIFGDTMCRLTSYVQSVSI SVSIFSLVFTAVERYQLIVNPRGWKPSVTHAYWGITLIWLFSLLLSIPFFLSYHLTDEPF RNLSLPTDLYTHQVACVENWPSKKDRLLFTTSLFLLQYFVPLGFILICYLKIVICLRRRN AKVDKKKENEGRLNENKRINTMLISIVVTFGACWLPRISSMSSLTGIMRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II (HLA-DRA) (19-26.1), CF568 conjugate, 0.1mg/mL
BNC681082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ITPKB Human Gene Knockout Kit (CRISPR)
KN423964 1 Kit

ITPKB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospholipase C beta 3/PLCB3 Recombinant Rabbit Monoclonal Antibody [JE39-14]
HA721561 100 µL

Phospholipase C beta 3/PLCB3 Recombinant Rabbit Monoclonal Antibody [JE39-14]

Sign In for Pricing
View Details
1-Nitroadamantane
TRC-N491400-1G 1 g

1-Nitroadamantane

Sign In for Pricing
View Details
SH3GLB2 (NM_020145) Human Over-expression Lysate
LC402767 20 µg

SH3GLB2 (NM_020145) Human Over-expression Lysate

Sign In for Pricing
View Details
DAX-J2™ Red
16301-AAT 1 mg

DAX-J2™ Red

Sign In for Pricing
View Details