Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Probable D, D-dipeptide transport system permease protein ddpC (ddpC)

This Recombinant Escherichia coli Probable D, D-dipeptide transport system permease protein ddpC (ddpC) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Probable D, D-dipeptide transport system permease protein ddpC

UniProt

P77463

Expression Region

1-298

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMLSEETSAVRPQKQTRFNGAKLVWMLKGSPLTVTSAVIIVLMLLMMIFSPWLATHDPNA IDLTARLLPPSAAHWFGTDEVGRDLFSRVLVGSQQSILAGLVVVAIAGMIGSLLGCLSGV LGGRADAIIMRIMDIMLSIPSLVLTMALAAALGPSLFNAMLAIAIVRIPFYVRLARGQAL VVRQYTYVQAAKTFGASRWHLINWHILRNSLPPLIVQASLDIGSAILMAATLGFIGLGAQ QPSAEWGAMVANGRNYVLDQWWYCAFPGAAILLTAVGFNLFGDGIRDLLDPKAGGKQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPP25L Protein Vector (Human) (pPM-C-His)
PV124613 500 ng

RPP25L Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Duo Double Nickase Plasmid (h2)
sc-408168-NIC-2 20 µg

Duo Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
COL11A1 rabbit pAb
ES4752-01 50 µL

COL11A1 rabbit pAb

Sign In for Pricing
View Details
COL11A1 rabbit pAb
ES4752-02 100 µL

COL11A1 rabbit pAb

Sign In for Pricing
View Details
Ethambutol-d4 Dihydrochloride (EMB)
011411 1 mg

Ethambutol-d4 Dihydrochloride (EMB)

Sign In for Pricing
View Details
MED9 (NM_018019) Human Over-expression Lysate
E45H10514-2 20 µg

MED9 (NM_018019) Human Over-expression Lysate

Sign In for Pricing
View Details