Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Mitochondrial uncoupling protein 3 (UCP3)

This Recombinant Pig Mitochondrial uncoupling protein 3 (UCP3) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 3, UCP 3, Solute carrier family 25 member 9

UniProt

O97649

Expression Region

1-308

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGLKPPEVPPTTAVKLLGAGTAACFADLLTFPLDTAKVRLQIQGENQAARSAQYRGVLG TILTMVRNEGPRSPYNGLVAGLQRQMSFASIRIGLYDSVKQLYTPKGSDHSSITTRILAG CTTGAMAVTCAQPTDVVKVRFQASIHAGPRSNRKYSGTMDAYRTIAREEGVRGLWKGILP NITRNAIVNCAEMVTYDVIKEKVLDYHLLTDNLPCHFVSAFGAGFCATVVASPVDVVKTR YMNSPPGQYQNPLDCMLKMVTQEGPTAFYKGFTPSFLRLGSWNVVMFVSYEQLKRALMKV QMLRESPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Thymic Stromal Lymphopoietin ELISA kit
GTR10379805 96 Well

Porcine Thymic Stromal Lymphopoietin ELISA kit

Sign In for Pricing
View Details
Anti-KLK3 Mouse mAb
MBS476308-01 0.1 mL

Anti-KLK3 Mouse mAb

Sign In for Pricing
View Details
Anti-KLK3 Mouse mAb
MBS476308-02 5x 0.1 mL

Anti-KLK3 Mouse mAb

Sign In for Pricing
View Details
UVI 3003
HY-107500-01 5 mg

UVI 3003

Sign In for Pricing
View Details
UVI 3003
HY-107500-02 10 mM - 1 mL

UVI 3003

Sign In for Pricing
View Details
UVI 3003
HY-107500-03 10 mg

UVI 3003

Sign In for Pricing
View Details