Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zinc transporter zitB (zitB)

This Recombinant Zinc transporter zitB (zitB) spans the amino acid sequence from region 1-313.

Product Specifications

Product Name Alternative

Zinc transporter zitB

UniProt

Q83SA2

Expression Region

1-313

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVVGGFLSGSLALLADAGHMLTDTAA LLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITILIVWEAIERFRTPRPVE GGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGDLLGSVGAIIAALIIIWT GWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDIAELKRRMCREIPEVRNVH HVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQIEHTTIQMEYQPCHRPDCH LNEGVSGHSHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCT6 (m) -PR
sc-150172-PR 10 µM - 20 µL

OCT6 (m) -PR

Sign In for Pricing
View Details
Recombinant Human PCCB Protein
E30P61471A 50 µg

Recombinant Human PCCB Protein

Sign In for Pricing
View Details
FOXP4 Peptide (AAP37395)
AAP37395-100UG 100 µg

FOXP4 Peptide (AAP37395)

Sign In for Pricing
View Details
Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial
RPC30611-01 20 µg

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial

Sign In for Pricing
View Details
Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial
RPC30611-02 100 µg

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial

Sign In for Pricing
View Details
Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial
RPC30611-03 1 mg

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial

Sign In for Pricing
View Details