Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Butyrophilin subfamily 3 member A1 (BTN3A1) . Accession Number: O00481; BTN3A1. Expression Region: 30-254aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 40.2kda. Target Synonyms: CD277 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Butyrophilin subfamily 3 member A1 (BTN3A1), partial is a purified Recombinant Protein.

Accession Number

O00481; BTN3A1

Expression Region

30-254aa

Host

E. coli

Target

Butyrophilin subfamily 3 member A1 (BTN3A1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD277

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-500 1x 500 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF647 conjugate, 0.1mg/mL
BNC472561-500 1x 500 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/1074), CF640R conjugate, 0.1mg/mL
BNC401017-100 1x 100 µL

SOX10 (SOX10/1074), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/796), CF640R conjugate, 0.1mg/mL
BNC400796-100 1x 100 µL

Bcl-2 (BCL2/796), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details