Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein translocase subunit SecF (secF)

This Recombinant Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

E9RGS4

Expression Region

1-315

Origin

Vibrio alginolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQILKAEKTIGFMRWSKVAFVFSIFMIAASIFTLSTKWLNWGLDFTGGTLIEVGFEKPA NLEKIRTALDAKGFGDATVQNFGSAREVMVRLRPRDDVSGETLGNQIIGAIKDGTGESVE MRRIEFVGPNVGDELTEAGGLAILVSLICILLYVSMRFEWRLAAGAVMALAHDIIITLGV FSFLQIEVDLTIVAALLTVVGYSLNDTIVVFDRIRENFRKMRKGEPADIMDASITQTLSR TLITSGTTLFVVIALFMQGGAMIHGFATALLLGITVGTYSSIYVASALALKLGIQKEHLM PPQVEKEGAEFDEMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit
MBS7274498-01 48 Well

Porcine anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit
MBS7274498-02 96 Well

Porcine anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit
MBS7274498-03 5x 96 Well

Porcine anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit

Sign In for Pricing
View Details
Porcine anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit
MBS7274498-04 10x 96 Well

Porcine anti-Leucine Rich Glioma-Inactivated Protein 1 Antibody ELISA Kit

Sign In for Pricing
View Details
Anti-DHODH Antibody Picoband® (monoclonal, 4E3), Cy3 Conjugate
M04035-Cy3 100 µg/Vial

Anti-DHODH Antibody Picoband® (monoclonal, 4E3), Cy3 Conjugate

Sign In for Pricing
View Details
NSC 109555
orb1695860-01 1 mg

NSC 109555

Sign In for Pricing
View Details