Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 165 (Tmem165)

This Recombinant Mouse Transmembrane protein 165 (Tmem165) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Transmembrane protein 165, TPA-regulated locus protein, Transmembrane protein PFT27, Transmembrane protein TPARL

UniProt

P52875

Expression Region

1-323

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPAQQLQPQPAAV QGLEPARAEKGLTPVAPVHTNKEDAAAQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM AMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGIRMLREGLK MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPDVETGTSTAIPQKKWLHFISPIFVQAL TLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVT IIGGIVFLAFAFSALFISPESGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®750 Protein Labeling Kit , 3x (1mg) labelings
#92221 1 Kit

CF®750 Protein Labeling Kit , 3x (1mg) labelings

Sign In for Pricing
View Details
CAMK2D Rabbit Polyclonal Antibody
TA362576 100 µL

CAMK2D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRITC Conjugated Goat Affinity Purified Antibody to Human IgA
RAF-002-2 2 mL

TRITC Conjugated Goat Affinity Purified Antibody to Human IgA

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), CF594 conjugate, 0.1mg/mL
BNC941623-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Bridging Integrator 2/BIN2 Protein (His Tag)
PKSH032131-01 10 µg

Recombinant Human Bridging Integrator 2/BIN2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Bridging Integrator 2/BIN2 Protein (His Tag)
PKSH032131-02 50 µg

Recombinant Human Bridging Integrator 2/BIN2 Protein (His Tag)

Sign In for Pricing
View Details