Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Myxococcus xanthus Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD)

This Recombinant Myxococcus xanthus Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

O30387

Expression Region

1-335

Origin

Myxococcus xanthus (strain DK 1622)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHSSLPGYFGPLFAVFLFVLGLCVGSFLNVVIARVPLDQSIVRPRSRCPRCGHVLAWYE NIPLLSWLALRARCRGCGVPISVRYPLVELLTGLLFFACLRRFGWTYELVPALVLVSLLV PLAFIDLDHWILPLSMTVPGMLAGIALAFPLGMDAFRDALMGAAVGFLSFRMMEYVGWKV FQREALGAGDKYLVAMLGAFLTWRALLGVLLFASMQGAVVGILMLLATGRAGPRTENTQD EPAGDAPPLTMTWEFTQPGLPLWKRLLLVPVCLLVQPIPDAPLDEEGEEEEWVPERTSIP FGPWLALAGLELLLLGPWLSRVLPADIAMMLGGLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human M-Phase Inducer Phosphatase 3 (CDC25C) ELISA Kit
abx386414 96 Tests

Human M-Phase Inducer Phosphatase 3 (CDC25C) ELISA Kit

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Probable ABC transporter permease protein yesQ (yesQ)
orb2910612-01 20 µg

Recombinant Bacillus subtilis Probable ABC transporter permease protein yesQ (yesQ)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Probable ABC transporter permease protein yesQ (yesQ)
orb2910612-02 100 µg

Recombinant Bacillus subtilis Probable ABC transporter permease protein yesQ (yesQ)

Sign In for Pricing
View Details
Hsa-miR-29c-5p miRNA Antagomir
orb1915747-01 10 nmol

Hsa-miR-29c-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-29c-5p miRNA Antagomir
orb1915747-02 20 nmol

Hsa-miR-29c-5p miRNA Antagomir

Sign In for Pricing
View Details
Heg1 ORF Vector (Mouse) (pORF)
ORF047087 1.0 µg DNA

Heg1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details