Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Probable ABC transporter permease protein yesQ (yesQ)

This Recombinant Bacillus subtilis Probable ABC transporter permease protein yesQ (yesQ) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

Probable ABC transporter permease protein yesQ

UniProt

O31520

Expression Region

1-296

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPVNQPVREAPVFERKKAGRVSPKRILFHVFTATLAVLLLYPVIWLFVSSFKESASIFT TSHSLIPDPFILSNYAEGWKGIAGQPFLTFIKNSAIIVGLSTIGAVMSSAVIAYGFARIP FKGKKFWFACMMGTLMLPHEVLMIPQYIMFAKLDWLNSFKPIVVPQFFGHAFFIFLMIQF IRTIPEELDEAARIDGCGRFACFWRIILPLIAPALATSAIFSFYWKWEELIQPLLYLNKP ELYPVSLALKLFLDTESASNWGAMFAMSAVSLLPVILVFFLFQKYIVQGISTTGLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-100 1x 100 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details