Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli PTS system mannitol-specific cryptic EIICB component (cmtA)

This Recombinant Escherichia coli PTS system mannitol-specific cryptic EIICB component (cmtA) spans the amino acid sequence from region 1-462.

Product Specifications

Product Name Alternative

PTS system mannitol-specific cryptic EIICB component, EIICB-Mtl, EII-Mtl, Including the following 2 domains:, Mannitol permease IIC component, PTS system mannito

UniProt

P69826

Expression Region

1-462

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENKSARAKVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWLPNEHFAKIVGPMITYL LPVMIGSTGGHLVGGKRGAVMGGIGTIGVIVGAEIPMFLGSMIMGPLGGLVIKYVDKALE KRIPAGFEMVINNFSLGIAGMLLCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPLLSV INEPAKVLFLNNAIDQGVYYPLGMQQASVNGKSIFFMVASNPGPGLGLLLAFTLFGKGMS KRSAPGAMIIHFLGGIHELYFPYVLMKPLTIIAMIAGGMSGTWMFNLLDGGLVAGPSPGS IFAYLALTPKGSFLATIAGVTVGTLVSFAITSLILKMEKTVETESEDEFAQSANAVKAMK QEGAFSLSRVKRIAFVCDAGMGSSAMGATTFRKRLEKAGLAIEVKHYAIENVPADADIVV THASLEGRVKRVTDKPLILINNYIGDPKLDTLFNQLTAEHKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amino(3-chlorophenyl)acetic Acid
TRC-A604408-5G 5 g

Amino(3-chlorophenyl)acetic Acid

Sign In for Pricing
View Details
SensiStain™ Anti-TAG-72 Antibody
HY000242 0.1 mL

SensiStain™ Anti-TAG-72 Antibody

Sign In for Pricing
View Details
Recombinant Mouse LAMP2/CD107b Protein (His Tag)
PKSM040486 100 µg

Recombinant Mouse LAMP2/CD107b Protein (His Tag)

Sign In for Pricing
View Details
BCL10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]
TA800445AM 100 µL

BCL10 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H9]

Sign In for Pricing
View Details
MAN2B1 Human Gene Knockout Kit (CRISPR)
KN400638 1 Kit

MAN2B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS642729 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details