Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein OtCpg00060 (OtCpg00060)

This Recombinant Uncharacterized membrane protein OtCpg00060 (OtCpg00060) spans the amino acid sequence from region 1-537.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein OtCpg00060, ORF537

UniProt

Q0P3P6

Expression Region

1-537

Origin

Ostreococcus tauri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENSIGLGLIHGLMYGIVPVAPWFVALKRYLLEGKEKGQLAVAGTIAGQVTLLALTFFGW SRVLWVWYYFEPALIILGTMAVVRCALDCWVEQESSLRTAALGPGAGQLASKQEGLYYFL MSFGLMFCNPLHLEGSQTLLSSIPGNRYVYLLAFTVSYTAIIFIFWVTLGYRIFGKAYSG FGAQQTLNRYRIRRVSVGIVAALFLQFANCTPEALVIYHWDSLLAYTPFDGLKHHRTRGY TWEPSSDNAFELSRQSYRATNRAGVSFEQGAKRAVQFKPFWNTETRFDECNQVRERELSN EDWNAEATFHEFQGINQGVLRARSVPFNLYMVPNWEKQEDKNYLLTLRQIRDEMDDKLMA ESSPQERFLVSPFTDNLDYEVDYQVYPELMAEKAQTKTAYADMVKLIRGTKWTSNHVHLG DGTDVEMSYAKLHALPAEVRLPWHYPVVKPTEVVVQTSSTDTPDSVQLLNDELQENLHFF SNEPERIQQNVYKRLWEHRTFGKVTPRMIDDKVQKRLDDRVNMRREAYVSSNPTKAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBP46 Antibody
57-525 400 µL

UBP46 Antibody

Sign In for Pricing
View Details
AQP2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
12220156 3x 1.0 µg DNA

AQP2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
GCIP interacting protein p29 (SYF2) Mouse Monoclonal Antibody [Clone:6A5]
E45M18375 100 µg

GCIP interacting protein p29 (SYF2) Mouse Monoclonal Antibody [Clone:6A5]

Sign In for Pricing
View Details
TFIIB (General Transcription Factor IIB, General Transcription Factor TFIIB, Gtf2b, RNA Polymerase II Transcription Factor IIB, S300 II, S300-II, TF IIB, TF2B, TF2B HUMAN, TFIIB, Transcription Initiation Factor IIB)
381723 100 µL

TFIIB (General Transcription Factor IIB, General Transcription Factor TFIIB, Gtf2b, RNA Polymerase II Transcription Factor IIB, S300 II, S300-II, TF IIB, TF2B, TF2B HUMAN, TFIIB, Transcription Initiation Factor IIB)

Sign In for Pricing
View Details
IGSF4B discontinued
390341 200 µL

IGSF4B discontinued

Sign In for Pricing
View Details
Hsp60 (HSPD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A2]
TA800758BM 100 µL

Hsp60 (HSPD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A2]

Sign In for Pricing
View Details