Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lipid A export ATP-binding/permease protein MsbA (msbA)

This Recombinant Lipid A export ATP-binding/permease protein MsbA (msbA) spans the amino acid sequence from region 1-582.

Product Specifications

Product Name Alternative

Lipid A export ATP-binding/permease protein MsbA, EC= 3.6.3.-

UniProt

Q66CI3

Expression Region

1-582

Origin

Yersinia pseudotuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNDKDLSTWQTFRRLWPTISPYKAGLIVAAIALILNAASDTFMLSLLKPLLDDGFGNSN SSILKWMPLAVIGLMVVRGVTGFVSSYCISWVSGKVVMHIRRRLFSHMMGMPVSFFDQQS TGTLLSRITYDSEQVAASSSSALVTVVREGASIIGLFIMMFYYSWQLSLILIVIAPIVSI SIRLVSKRFRNISKNMQNTMGEVTTSAEQMLKGHKEVLIFGGQKVETERFDAVSNRMRQQ GMKLVSASSISDPIIQLIASFALALVLYAASFPSVMETLTAGTITVVFSAMIALMRPLKS LTNVNTQFQRGMAACQTLFSILDMEQEKDEGKLEVERAKGDIEFRHVTFYYPGKDTPALN DINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGALRNQVA LVSQNVHLFNDTVANNIAYARNEQYSRAEIEEAARMAYAMDFINKMEHGLDTVIGENGIM LSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVIEDGRIVERGVHAELLVQQGVYAQLNRMQFGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSBPL11 (NM_022776) Human 3' UTR Clone
SC215909 10 µg

OSBPL11 (NM_022776) Human 3' UTR Clone

Sign In for Pricing
View Details
ZBED5 Rabbit Polyclonal Antibody (Cy5)
orb927512 100 µL

ZBED5 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
YY1AP1 (YY1-Associated Protein 1, Hepatocellular Carcinoma Susceptibility Protein, Hepatocellular Carcinoma-Associated Protein 2, YY1AP1, HCCA2, YY1AP) (Biotin)
MBS6460311-01 0.2 mL

YY1AP1 (YY1-Associated Protein 1, Hepatocellular Carcinoma Susceptibility Protein, Hepatocellular Carcinoma-Associated Protein 2, YY1AP1, HCCA2, YY1AP) (Biotin)

Sign In for Pricing
View Details
YY1AP1 (YY1-Associated Protein 1, Hepatocellular Carcinoma Susceptibility Protein, Hepatocellular Carcinoma-Associated Protein 2, YY1AP1, HCCA2, YY1AP) (Biotin)
MBS6460311-02 5x 0.2 mL

YY1AP1 (YY1-Associated Protein 1, Hepatocellular Carcinoma Susceptibility Protein, Hepatocellular Carcinoma-Associated Protein 2, YY1AP1, HCCA2, YY1AP) (Biotin)

Sign In for Pricing
View Details
Herpes Simplex Virus I, Nucleocapsid Protein, 155kD (HSV I) (APC) discontinued
H2033-05-APC 100 µL

Herpes Simplex Virus I, Nucleocapsid Protein, 155kD (HSV I) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 2 (cbiM2)
orb2912086-01 20 µg

Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 2 (cbiM2)

Sign In for Pricing
View Details