Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 2 (cbiM2)

This Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 2 (cbiM2) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Putative cobalt transport protein CbiM 2, Energy-coupling factor transporter probable substrate-capture protein CbiM 2, ECF transporter S component CbiM 2

UniProt

A2SSE8

Expression Region

1-231

Origin

Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHIMEGYLPIGWCIFWAVLSAPFVIYGIWKMTKMIQEDRRVLPLMAVCGAFVFVLSALKI PSVTGSCSHPTGTGLSAAFFGPFITSVLGTIVLLFQALLLAHGGLTTLGANVFSMAIAGP FIAWLVFVGLRKTGKVGIGVAVFITAAVANLVTYTVTSLQLALVFPVEGSILNAFIAFAG IFAVTQIPLAIIEGIICALVAKYIVRVKPEILKKLGIIQDEEIAKIQGEAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-500 1x 500 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-500 1x 500 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-500 1x 500 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-100 1x 100 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details