Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0088 (Mb0088)

This Recombinant Uncharacterized protein Mb0088 (Mb0088) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0088

UniProt

P64682

Expression Region

1-220

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNANFSILVDFAAGGLVLASVLIVWRRDLRAIVRLLAWQGAALAAIPLLRGIRDNDRAL IAVGIAVLALRALVLPWLLARAVGAEAAAQREATPLVNTASSLLITAGLTLTAFAITQPV VNLEPGVTINAVPAAFAVVLIALFVMTTRLHAVSQAAGFLMLDNGIAATAFLLTAGVPLI VELGASLDVLFAVIVIGVLTGRLRRIFGDADLDKLRELRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCG1 Antibody - C-terminal region : Biotin (ARP33086_P050-Biotin)
ARP33086_P050-Biotin 100 µL

PLCG1 Antibody - C-terminal region : Biotin (ARP33086_P050-Biotin)

Sign In for Pricing
View Details
Cdx1 3'UTR GFP Stable Cell Line
TU252132 1.0 mL

Cdx1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HERPUD2 antibody - N-terminal region (ARP49716_P050)
ARP49716_P050 100 µL

HERPUD2 antibody - N-terminal region (ARP49716_P050)

Sign In for Pricing
View Details
4-Methylsulfonylbenzylamine hydrochloride
16062914 1 g

4-Methylsulfonylbenzylamine hydrochloride

Sign In for Pricing
View Details
PDL1 Antibody [1D7]
RF16038-01 0.02 mg

PDL1 Antibody [1D7]

Sign In for Pricing
View Details
PDL1 Antibody [1D7]
RF16038-02 0.1 mg

PDL1 Antibody [1D7]

Sign In for Pricing
View Details