Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia chaffeensis ATP synthase subunit a (atpB)

This Recombinant Ehrlichia chaffeensis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2GFB2

Expression Region

1-243

Origin

Ehrlichia chaffeensis (strain Arkansas)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANPLDQFKISTIFKLPSIGGYNIDFTNASLFMVLSTLIISLFCYIGLRKENILPNSMQ LIIEAIYNFIVSTIESNVGRKGLQYIPLVFTIFTFIATCNLLGVLPLGFTVTSHIAVTFA ISMVVFISVTAIGFKHQGIHFLRILLPKGTPGWLAPMMVFIELFAYCARPVSLSIRLAAN MIAGHTIIKVIAGFVIKMNIFLTPLPMAFIIILIGFEIFVAILQAYIFTVLTCVYLSDAI NEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY6G5C siRNA (Human)
CRJ2895-01 15 nmol

LY6G5C siRNA (Human)

Sign In for Pricing
View Details
LY6G5C siRNA (Human)
CRJ2895-02 30 nmol

LY6G5C siRNA (Human)

Sign In for Pricing
View Details
P73 Antibody (Phospho-Tyr99)
OAAF07770-100UG 100 µg

P73 Antibody (Phospho-Tyr99)

Sign In for Pricing
View Details
Stirring Heating Mantle
LX302SHM 1 Unit

Stirring Heating Mantle

Sign In for Pricing
View Details
Enc1 Rat shRNA Lentiviral Particle (Locus ID 294674)
TL700477V 500 µL Each

Enc1 Rat shRNA Lentiviral Particle (Locus ID 294674)

Sign In for Pricing
View Details
GPM6A Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1579144 100 µL

GPM6A Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details