Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha ATP synthase subunit a (ATP6)

This Recombinant Marchantia polymorpha ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P26853

Expression Region

1-252

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MACSPLEQFAIIQLIPIHIGNLYFSFTNSSLFMLLTISLVLLLVHFVTLNGGNLVPNAWQ SFVEMIYDFVLNLVNEQISGASSVKQRFFPLIYVTFTFLLFCNLIGMIPYSFTVTSHFII TLGLSFSLFIGITIVGFQTHGLHFFSILLPQGVPLPLAPFLVLLELISYCFRALSLGIRL FANMMAGHSLVKILSGFAWTMLSMGGILYLGQLAPFFIVFALTGLELGVAILQAYVFTIL LCIYLNDAINLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OX40 / CD134/ TNFRSF4 (Immuno-Oncology Target) (OX40/3108), CF640R conjugate, 0.1mg/mL
BNC403108-100 1x 100 µL

OX40 / CD134/ TNFRSF4 (Immuno-Oncology Target) (OX40/3108), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-01 20 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-02 100 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-03 500 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-04 1 mg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Slc17a4 Mouse Gene Knockout Kit (CRISPR)
KN515899 1 Kit

Slc17a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details