Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema denticola Cobalamin synthase (cobS)

This Recombinant Treponema denticola Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q73K39

Expression Region

1-260

Origin

Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGFILALQFFTRIPININIDFNEKNIKRAFYFLPLIGGLIAGLVLIPIYFLPQKYIEIS GFISLLLYLFLTGSIHLDGVGDTIDGFFSARKKEKILEIMQDPRIGTYGTIGLNVFLLLR YINYSTIIPDAGLLILAGIISRLSGLAVVVFSKPAKDTGLGLLFHKSASKFSFFFWLVLV CFLSLFTPEIAAFSKIQGTFILVERLKYLLLPLTAFILTFIIIRISYKKIGGITGDVNGL IVELTELAVLSTSFFINVHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106, ID (VCAM1, L1CAM, Vascular cell adhesion protein 1, INCAM-100, CD106) (MaxLight 405)
MBS6282723-01 0.1 mL

CD106, ID (VCAM1, L1CAM, Vascular cell adhesion protein 1, INCAM-100, CD106) (MaxLight 405)

Sign In for Pricing
View Details
CD106, ID (VCAM1, L1CAM, Vascular cell adhesion protein 1, INCAM-100, CD106) (MaxLight 405)
MBS6282723-02 5x 0.1 mL

CD106, ID (VCAM1, L1CAM, Vascular cell adhesion protein 1, INCAM-100, CD106) (MaxLight 405)

Sign In for Pricing
View Details
TANK Antibody
3877-002mg 0.02 mg

TANK Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Transcobalamin II Antibody (049) [Alexa Fluor 750]
NBP2-89597AF750 0.1 mL

Rabbit Monoclonal Transcobalamin II Antibody (049) [Alexa Fluor 750]

Sign In for Pricing
View Details
Mouse recombinant FGF-2 (Fibroblast growth factor-basic) protein, AF
PROTP15655-2-20ug 20 µg

Mouse recombinant FGF-2 (Fibroblast growth factor-basic) protein, AF

Sign In for Pricing
View Details
Human Total Ret ELISA Kit Intracellular
NR-E10801-01 96 Tests

Human Total Ret ELISA Kit Intracellular

Sign In for Pricing
View Details