Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant FGF-2 (Fibroblast growth factor-basic) protein, AF

Basic fibroblast Growth Factors (FGF-2, bFGF), a pleiotropic cytokine, plays multiple roles in different cells and tissues. FGF-2 can stimulate smooth muscle cell growth, wound healing, and tissue repair. In addition, FGF-2 has been shown to regulate the generation of neurons and astrocytes from progenitor cells. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. As a multifunctional cytokine, FGF-2 is first isolated from the pituitary. Later, it was identified from various cell types including cardiac myocytes, cardiac fibroblasts, endothelial cells, and smooth muscle cells.

Product Specifications

Synonyms

HBGF-2, Prostatropin

Gene Name

Fgf2

UniProt

P15655/P13109

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <1.5 ng/mL. The specific activity of recombinant mouse FGF-2 is approximately >1 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 0.01% sarkosyl in 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 17.2 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

USP43 Protein Lysate (Human) with C-Ha Tag
49327031 100 µg

USP43 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
5-Aminoisophthalic acid
A-515-250-5kg 5 Kg

5-Aminoisophthalic acid

Sign In for Pricing
View Details
12 (R) -Hydroxyeicosa-5Z,8Z,10E,14Z-tetraenoic acid (HETE)
MBS565444-01 0.05 mg

12 (R) -Hydroxyeicosa-5Z,8Z,10E,14Z-tetraenoic acid (HETE)

Sign In for Pricing
View Details
12 (R) -Hydroxyeicosa-5Z,8Z,10E,14Z-tetraenoic acid (HETE)
MBS565444-02 5x 0.05 mg

12 (R) -Hydroxyeicosa-5Z,8Z,10E,14Z-tetraenoic acid (HETE)

Sign In for Pricing
View Details
RPS14 (40S Ribosomal Protein S14, PRO2640) (MaxLight 550)
138311-ML550 100 µL

RPS14 (40S Ribosomal Protein S14, PRO2640) (MaxLight 550)

Sign In for Pricing
View Details
Rat Thrombospondin 1 (THBS1) Protein
abx069279-01 10 µg

Rat Thrombospondin 1 (THBS1) Protein

Sign In for Pricing
View Details