Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dichelobacter nodosus Undecaprenyl-diphosphatase (uppP)

This Recombinant Dichelobacter nodosus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A5EW93

Expression Region

1-267

Origin

Dichelobacter nodosus (strain VCS1703A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLWQAFILSLIQGITEFLPISSSGHLVITRELLHWQDAGVAFDAFTGLGTLTAVLFYYR KDVCSILYHWFRQFRHCDAPPAPEAKLGNQLIVATLPALLIGFMVKDHIDALTHRPLLIA STTMIFAIFLAAADFWGRKKLSLPETNYRQAFYYGLAQTLALVPGVSRSGITLTAGLAMH FSRESAARFSFLQSIPISAAAGGYGLWKLATNPSDFSWQLIALSYVTATLAAYVCIALFI RFLNTVGMMPHVIYRLLLGAYLFFVFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAIAP2 (NM_017450) Human Recombinant Protein
TP304233 20 µg

BAIAP2 (NM_017450) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human TGFBI/BIGH3 Protein (His Tag)
PKSH031520 100 µg

Recombinant Human TGFBI/BIGH3 Protein (His Tag)

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF568 conjugate, 0.1mg/mL
BNC681540-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Melanophilin (mLPH) (NM_024101) Human Over-expression Lysate
LY402978 100 µg

Melanophilin (mLPH) (NM_024101) Human Over-expression Lysate

Sign In for Pricing
View Details
SECTM1 Human Recombinant Protein
TP721359 25 µg

SECTM1 Human Recombinant Protein

Sign In for Pricing
View Details
Progesterone Receptor Antibody
KC-3516-01 50 μL

Progesterone Receptor Antibody

Sign In for Pricing
View Details