Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Comephorus dybowskii Rhodopsin (rho)

This Recombinant Comephorus dybowskii Rhodopsin (rho) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O42327

Expression Region

1-289

Origin

Comephorus dybowskii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YLVNPAAYAALGAYMFLLILIGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALSCSVPPLVGWSRYIPEAMQCSCGVDYYTRAEGFNTESFVLYMFT VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRSEKEVSRMVVLMVIGFLVCWLPYA STAWWIFCNQGSEFGPVFMTIPAFFAKSSAIYNPMIYICMNKQFRHCMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM4 Adenovirus (Human)
36328052 1.0 mL

PDLIM4 Adenovirus (Human)

Sign In for Pricing
View Details
CDKN2A/p16-INK4a Polyclonal Antibody, Cy5.5 Conjugated
bs-23797R-Cy5.5 100 µL

CDKN2A/p16-INK4a Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal SLC14A1 Antibody (888418) [Janelia Fluor 635]
FAB8238JF635 0.1 mL

Mouse Monoclonal SLC14A1 Antibody (888418) [Janelia Fluor 635]

Sign In for Pricing
View Details
LV CryoOil™
LVCO-5 5 mL

LV CryoOil™

Sign In for Pricing
View Details
Anti-FOH1B FOLH1B Antibody
B2021962 100 µL

Anti-FOH1B FOLH1B Antibody

Sign In for Pricing
View Details
Dacomitinib (PF299804, PF299)
A8319-5.1 10 mM (in 1mL DMSO)

Dacomitinib (PF299804, PF299)

Sign In for Pricing
View Details