Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri ATP synthase subunit a (atpB)

This Recombinant Pseudomonas stutzeri ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A4VS68

Expression Region

1-290

Origin

Pseudomonas stutzeri (strain A1501)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTPAEYIQHHLQNLTYGKLPAGYERADGSILDQATWTIAQTGAEARDMGFMAVHLDTL GWSLLMGAIFILLFRSAAKAATAGVPGKLQNLVEMCVEFVEGVVKDTFHGRNPLIAPLAL TIFVWVFLMNSLKWIPVDYIPGIAHLLGLPAFKIVPTADPNGTFGLSLGVFILILFYSFK VKGFGGFTKELAFTPFNHWSLVPFNLFLEILGLLTKPLSLALRLFGNMYAGEVVFILIAL LPFYVQWTLNVPWAIFHILVIPLQAFIFMVLTVVYLSSAHEDHGHAELTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ATP synthase subunit a (atpB)
orb2917414-01 20 µg

Recombinant ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant ATP synthase subunit a (atpB)
orb2917414-02 100 µg

Recombinant ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
IFN-α8 CRISPR Activation Plasmid (h2)
sc-410832-ACT-2 20 µg

IFN-α8 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Human CD3E protein
orb706889-01 10 µg

Human CD3E protein

Sign In for Pricing
View Details
Human CD3E protein
orb706889-02 50 µg

Human CD3E protein

Sign In for Pricing
View Details
Human CD3E protein
orb706889-03 500 µg

Human CD3E protein

Sign In for Pricing
View Details