Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3K1K0

Expression Region

1-238

Origin

Streptococcus agalactiae serotype Ia

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESTSNPTVSFLGIDFDLTILAMSLLTITIIFILVFWASRKMTIKPKGKQNVLEYVYELV NNTISQNLGHYTKNYSLLMFILFSFVFIANNLGLMTSLKTHEHNFWTSPTANFGVDITLS LLVAFICHIEGIRKKGIGGYLKGFLSPTPAMLPMNLLEEVTNVASLALRLFGNIFSGEVV TGLLLQLAVLSPFTGPLAFALNIVWTAFSMFIGFIQAYVFIILSSSYIGHKVHGDEEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gsdmcl1-set siRNA/shRNA/RNAi Lentivector (Mouse)
22729094 4x 500 ng

Gsdmcl1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
SMARCB1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-6109R-BF680-01 20 µL

SMARCB1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
SMARCB1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-6109R-BF680-02 100 µL

SMARCB1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
MTCH2 (NM_014342) Human Over-expression Lysate
LS023788-100ug 100 µg

MTCH2 (NM_014342) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccnt2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3003505 3x 1.0 µg

Ccnt2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Slc7a9 Antibody
RQ6515 100 µg

Slc7a9 Antibody

Sign In for Pricing
View Details