Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Post-GPI attachment to proteins factor 3 (pgap3)

This Recombinant Danio rerio Post-GPI attachment to proteins factor 3 (pgap3) spans the amino acid sequence from region 20-316.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, PER1-like domain-containing protein 1

UniProt

A8WFS8

Expression Region

20-316

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DKEPVYRDCVKHCVRANCTGARLRGFQSTQPPYMALTGWTCRDDCRYQCMWTTVGLYQAE GYSIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSAVPCQSPMYHTITAFS LVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPAISSMVGVLL ILAFTSHVSYLTFVSFDYGYNMAANASIGIINLLWWLCWCWLNRRILPYWWRCGMVVLLL HGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHLLNTEKPGVKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A Bbd (H2AFB2) (NM_001017991) Human Over-expression Lysate
LY422230 100 µg

Histone H2A Bbd (H2AFB2) (NM_001017991) Human Over-expression Lysate

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (RFB4), CF405S conjugate, 0.1mg/mL
BNC041594-500 1x 500 µL

CD22 / BL-CAM (B-Cell Marker) (RFB4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Clusterin Human
OM296932-01 10 µg

Clusterin Human

Sign In for Pricing
View Details
Clusterin Human
OM296932-02 2 µg

Clusterin Human

Sign In for Pricing
View Details
Clusterin Human
OM296932-03 1 mg

Clusterin Human

Sign In for Pricing
View Details
Lyn Recombinant Rabbit Monoclonal Antibody [JE44-75]
HA721991 100 µL

Lyn Recombinant Rabbit Monoclonal Antibody [JE44-75]

Sign In for Pricing
View Details