Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q46LZ1

Expression Region

1-303

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHIFLALRSPGPELFQLGPFSLRWYGLLIAISVLVGLNLSSELASKKGLKKSLINDLLP ILVLASVIGARIYYVAFEWRNYTGKNFWSSINFLNLNIPIPSALEIWGGGIAIHGALIMG TLSIIFFCRWRQEHFWDVIDVLVPSVALGQAIGRWGNFFNNEAFGIPTNLPWKLFIPYRF RPEIFSTIDYFHPTFLYESVWNIFVFGILIFLFRKANKKDLKLPPGSLSCLYLITYSLGR FWIEGLRTDPLCLGGVPPFCEGGLRIAQLISLFLISAGLLGIWRIYVSKKALPDPSSMNG RNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD90.2 (30-H12) In Vivo Antibody - Low Endotoxin
ICH1066-50mg 50 mg

Anti-Mouse CD90.2 (30-H12) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
DKK3 (N-term) Rabbit Polyclonal Antibody
AP11554PU-N 400 µL

DKK3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Autophagy Related Protein 7 (ATG7) ELISA Kit
RDR-ATG7-Hu-01 96 Tests

Human Autophagy Related Protein 7 (ATG7) ELISA Kit

Sign In for Pricing
View Details
Human Autophagy Related Protein 7 (ATG7) ELISA Kit
RDR-ATG7-Hu-02 48 Tests

Human Autophagy Related Protein 7 (ATG7) ELISA Kit

Sign In for Pricing
View Details
DnaseIPolyclonal Antibody
E-AB-40592-01 25 µL

DnaseIPolyclonal Antibody

Sign In for Pricing
View Details
DnaseIPolyclonal Antibody
E-AB-40592-02 100 µL

DnaseIPolyclonal Antibody

Sign In for Pricing
View Details