Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10A2 (OR10A2)

This Recombinant Human Olfactory receptor 10A2 (OR10A2) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Olfactory receptor 10A2, HP4, Olfactory receptor OR11-86

UniProt

Q9H208

Expression Region

1-303

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFSSLPTEIQSLLFLTFLTIYLVTLMGNCLIILVTLADPMLHSPMYFFLRNLSFLEIGF NLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMAYDRYVAICSPLHYP VIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLRLVCADTA LFEIYAIVGTILVVMIPCLLILCSYTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYI SLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSLRNNEVKNALSRTVSKALALRN CIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL3 ELISA Kit
E019463 1 Each

Human IL3 ELISA Kit

Sign In for Pricing
View Details
Anti-RBM33 Polyclonal Antibody
TMAB-12143-01 50 μL

Anti-RBM33 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RBM33 Polyclonal Antibody
TMAB-12143-02 100 µL

Anti-RBM33 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RBM33 Polyclonal Antibody
TMAB-12143-03 200 µL

Anti-RBM33 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)
orb2937334-01 20 µg

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)
orb2937334-02 100 µg

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

Sign In for Pricing
View Details