Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

This Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-66.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1ICT5

Expression Region

1-66

Origin

Streptococcus pneumoniae (strain Hungary19A-6)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLV FSFIIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C2]
TA507243BM 100 µL

SMAD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C2]

Sign In for Pricing
View Details
Recombinant Human FGF-13 protein (His Tag)
PKSH034156-01 20 µg

Recombinant Human FGF-13 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FGF-13 protein (His Tag)
PKSH034156-02 100 µg

Recombinant Human FGF-13 protein (His Tag)

Sign In for Pricing
View Details
Recombinant HtrA2 Antibody
RC-16713-01 50 μL

Recombinant HtrA2 Antibody

Sign In for Pricing
View Details
Recombinant HtrA2 Antibody
RC-16713-02 100 µL

Recombinant HtrA2 Antibody

Sign In for Pricing
View Details
Recombinant HtrA2 Antibody
RC-16713-03 1 mL

Recombinant HtrA2 Antibody

Sign In for Pricing
View Details