Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6F1 (OR6F1)

This Recombinant Human Olfactory receptor 6F1 (OR6F1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Olfactory receptor 6F1, Olfactory receptor OR1-38

UniProt

Q8NGZ6

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTGNKTLPQDFLLLGFPGSQTLQLSLFMLFLVMYILTVSGNVAILMLVSTSHQLHTPMY FFLSNLSFLEIWYTTAAVPKALAILLGRSQTISFTSCLLQMYFVFSLGCTEYFLLAAMAY DRCLAICYPLHYGAIMSSLLSAQLALGSWVCGFVAIAVPTALISGLSFCGPRAINHFFCD IAPWIALACTNTQAVELVAFVIAVVVILSSCLITFVSYVYIISTILRIPSASGRSKAFST CSSHLTVVLIWYGSTVFLHVRTSIKDALDLIKAVHVLNTVVTPVLNPFIYTLRNKEVRET LLKKWKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS9 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-11511R-BF488 100 µL

BBS9 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Fish Interleukin 34 ELISA Kit
MBS016522 Inquire

Fish Interleukin 34 ELISA Kit

Sign In for Pricing
View Details
PI-9 (F-6) HRP
sc-390501 HRP 200 µg/mL

PI-9 (F-6) HRP

Sign In for Pricing
View Details
Phospho-MYPT1 (Thr852) Antibody [APR33508G]
APR33508G-01 50 µL

Phospho-MYPT1 (Thr852) Antibody [APR33508G]

Sign In for Pricing
View Details
Phospho-MYPT1 (Thr852) Antibody [APR33508G]
APR33508G-02 100 µL

Phospho-MYPT1 (Thr852) Antibody [APR33508G]

Sign In for Pricing
View Details
Phospho-MYPT1 (Thr852) Antibody [APR33508G]
APR33508G-03 200 µL

Phospho-MYPT1 (Thr852) Antibody [APR33508G]

Sign In for Pricing
View Details