Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein HVLF2 (US16)

This Recombinant Human cytomegalovirus Uncharacterized protein HVLF2 (US16) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Uncharacterized protein HVLF2

UniProt

P09717

Expression Region

1-309

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLRFPTATQRQIVFRRLFDSGNNDDYDEAAVVAVLGWVHRFEVVVRIAGLLLFQISAAV AVLGSFSLVFPTATLKSRPGFPCHVVWAPEVLLLVPVASALFVYFRYERPVLAQRNRHPR CRRPFRQLVLLLAGLLAHIPALGVTCACQEPREVLTSFVLTLVITLLCAEVVFICRDNCT LSDQFTLINGVWVVVFLVNVLIVFTRPWTWPLRLLLGFYSTVGLIFAGHFSQQVLFVRHV LMPRDVAHTSLQLFITFISLFFLILRIRNCQDLLSDLRLLELPSSDAMTLTPNDLSHASS STPLSTLSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(2,2,2-Trichloroethoxy)carbonyl] Nortilidine
TRC-T774170-10MG 10 mg

N-(2,2,2-Trichloroethoxy)carbonyl] Nortilidine

Sign In for Pricing
View Details
Abiraterone Tosylate
TRC-A108505-25MG 25 mg

Abiraterone Tosylate

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), 1mg/mL
BNUM1380-50 1x 50 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), 1mg/mL

Sign In for Pricing
View Details
EXTRAClean Urine Exosome and Free-Circulating RNA Isolation Maxi Kit
73520 15 Preparations

EXTRAClean Urine Exosome and Free-Circulating RNA Isolation Maxi Kit

Sign In for Pricing
View Details
Human Prickle 2 (PRICKLE2) activation kit by CRISPRa
GA116137 1 Kit

Human Prickle 2 (PRICKLE2) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS642728 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details