Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Chitin synthase export chaperone (CHS7)

This Recombinant Debaryomyces hansenii Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q6BUS8

Expression Region

1-309

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFGNFDTICNITSLPLCSVVGSVNETSYFTRGIVPDCYARSVELANTMVFQIGNAFVHF GGLIILLIIIFNVRAKYTAIGRTEMLFFFYLIICLIVSSLVVDCGVSPPSSGSYAYFVAV QLGLASASCICILYNGLLCFQFWEDGSRKSMWSLRVICFCWFVVNFIVALVTFKSWDSAL DSRKTMAMFVITYLINAIILAFYVISQIVLVVFALDSYWPLGAILLGVFFFVAGQVLTYE FSDDICRGASHYIDGLFFGSACNIFTVMMIYKFWDMITVDDLEFSVANVEHGVTAFGGDD EKRGSTIFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN8 Antibody (Center) [AMM08582G]
AMM08582G-01 50 µL

CLDN8 Antibody (Center) [AMM08582G]

Sign In for Pricing
View Details
CLDN8 Antibody (Center) [AMM08582G]
AMM08582G-02 100 µL

CLDN8 Antibody (Center) [AMM08582G]

Sign In for Pricing
View Details
CLDN8 Antibody (Center) [AMM08582G]
AMM08582G-03 200 µL

CLDN8 Antibody (Center) [AMM08582G]

Sign In for Pricing
View Details
CLDN8 Antibody (Center) [AMM08582G]
AMM08582G-04 400 µL

CLDN8 Antibody (Center) [AMM08582G]

Sign In for Pricing
View Details
*Mycoplasma Enrichment Supplement
MS 2075-01 5 Vials

*Mycoplasma Enrichment Supplement

Sign In for Pricing
View Details
*Mycoplasma Enrichment Supplement
MS 2075-02 5x 5 Vials

*Mycoplasma Enrichment Supplement

Sign In for Pricing
View Details