Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 867 (Olr867)

This Recombinant Rat Olfactory receptor 867 (Olr867) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 867, Gustatory receptor GUST27, Olfactory receptor 1172

UniProt

P34987

Expression Region

1-312

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILNCNPFSGLFLSMYLVTVLGNLLIILAVSSNSHLHNLMYFFLSNLSFVDICFISTTIP KMLVNIHSQTKDISYIECLSQVYFLTTFGGMDNFLLTLMACDRYVAICHPLNYTVIMNLQ LCALLILMFWLIMFCVSLIHVLLMNELNFSRGTEIPHFFCELAQVLKVANSDTHINNVFM YVVTSLLGLIPMTGILMSYSQIASSLLKMSSSVSKYKAFSTCGSHLCVVSLFYGSATIVY FCSSVLHSTHKKMIASLMYTVISPMLNPFIYSLRNKDVKGALGKLFIRVASCPLWSKDFR PKFILKPERQSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFTA Human Gene Knockout Kit (CRISPR)
KN427247 1 Kit

ZFTA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L3MBTL1 (NM_015478) Human Recombinant Protein
TP308022M 100 µg

L3MBTL1 (NM_015478) Human Recombinant Protein

Sign In for Pricing
View Details
Choline kinase alpha (CHKA) (NM_001277) Human Over-expression Lysate
LY400512 100 µg

Choline kinase alpha (CHKA) (NM_001277) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Phenoxyethyl-1,1,2,2-d4 Alcohol
TRC-P297901-10MG 10 mg

2-Phenoxyethyl-1,1,2,2-d4 Alcohol

Sign In for Pricing
View Details
Recombinant Human Vitamin D-Binding Protein/GC protein (His tag)
PDMH100111-01 20 µg

Recombinant Human Vitamin D-Binding Protein/GC protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Vitamin D-Binding Protein/GC protein (His tag)
PDMH100111-02 100 µg

Recombinant Human Vitamin D-Binding Protein/GC protein (His tag)

Sign In for Pricing
View Details