Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1009 (Olfr1009)

This Recombinant Mouse Olfactory receptor 1009 (Olfr1009) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 1009, Olfactory receptor 175-3

UniProt

Q8VFK1

Expression Region

1-314

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADENYTRITEFIFIGLRYHPNLQVFLFLLFLLFYLVTMTGNLGMIILIRVDSRLHTPMY FFLSHLSFVDICFSSVVAPKMLTDFFADKKAISFLGCVLQQWFFGFFVAIECLLLASMAY DRYVAICNPLLYSVAMSQRLCIQLVIGPYAVGFFNTMTHTTAAFRLPFCGSNIINHFFCD MSPILSLICADIRINKLLVFIVAGAVLIVSSTTIIVSYFHILIAILRIRSAEGRRKAFST CSSHVTAVSILYGTLFFIYVRPSAISSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKSA MGRTVAKAKVFLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF1A antibody
FNab08822 100 µg

TNFRSF1A antibody

Sign In for Pricing
View Details
Recombinant RUNX1/RUNX2/RUNX3 Antibody
RC-5180-01 50 μL

Recombinant RUNX1/RUNX2/RUNX3 Antibody

Sign In for Pricing
View Details
Recombinant RUNX1/RUNX2/RUNX3 Antibody
RC-5180-02 100 µL

Recombinant RUNX1/RUNX2/RUNX3 Antibody

Sign In for Pricing
View Details
Recombinant RUNX1/RUNX2/RUNX3 Antibody
RC-5180-03 1 mL

Recombinant RUNX1/RUNX2/RUNX3 Antibody

Sign In for Pricing
View Details
GRHL3 (NM_198174) Human Recombinant Protein
TP307857L 1 mg

GRHL3 (NM_198174) Human Recombinant Protein

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD1a Antibody[OKT-6]
E-AB-F11260-01 100 µg

AF/LE Purified Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details