Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C6 (OR6C6)

This Recombinant Human Olfactory receptor 6C6 (OR6C6) spans the amino acid sequence from region 1-314.

Product Specifications

Product Name Alternative

Olfactory receptor 6C6

UniProt

A6NF89

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKSMEIEFILLGLTDDPQLQIVIFLFLFLNYTLSLMGNLIIIILTLLDPRLKTPMYFF LRNFSFLEVIFTTVCIPRFLITIVTRDKTISYNNCATQLFFILLPGVTEFYLLAAMSYDR YVAICKPLHYPIIMSSKVCYQLVLSSWVTGFLIIFPPLVMGLKLDFCASKTIDHFMCETS PILQISCTDTHVLELMSFTLAVVTLVVTLVLVILSYTCIIKTILKFSSAQQRNKAFSTCT SHMIVVSMTYGSCIFMYIKPSAKERVTVSKGVALLYTSIAPLLNPFIYTLRNQQVKEVFW DVLQKNLCFSKRPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mertk sgRNA CRISPR Lentivector (Rat) (Target 3)
K7619204 1.0 µg DNA

Mertk sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Anti-CK-14 (Cytokeratin-14) KRT14 Rabbit Monoclonal Antibody, Clone#RM328
M01432-3 100 µL

Anti-CK-14 (Cytokeratin-14) KRT14 Rabbit Monoclonal Antibody, Clone#RM328

Sign In for Pricing
View Details
HUPF2/RENT2 Rabbit pAb, AP conjugated
orb2878945 100 µL

HUPF2/RENT2 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Anti-SEPT4/SEPTIN4 Antibody Picoband® Fluoro550 Conjugated
A09411-2-Fluoro550 100 µg/Vial

Anti-SEPT4/SEPTIN4 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Cytochrome P450 2A6 Polyclonal Antibody, FITC Conjugated
bs-12923R-FITC 100 µL

Cytochrome P450 2A6 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
AMPKa1/AMPKa2 Mouse mAb
A27099-01 20 µL

AMPKa1/AMPKa2 Mouse mAb

Sign In for Pricing
View Details