Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10A7 (OR10A7)

This Recombinant Human Olfactory receptor 10A7 (OR10A7) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 10A7, Olfactory receptor OR12-6

UniProt

Q8NGE5

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MICENHTRVTEFILLGFTNNPEMQVSLFIFFLAIYTVTLLGNFLIVTVTSVDLALQTPMY FFLQNLSLLEVCFTLVMVPKMLVDLVSPRKIISFVGCGTQMYFFFFFGSSECFLLSMMAY DRFVAICNPLHYSVIMNRSLCLWMAIGSWMSGVPVSMLQTAWMMALPFCGPNAVDHFFCD GPPVLKLVTVDTTMYEMQALASTLLFIMFPFCLILVSYTRIIITILRMSSATGRQKAFST CSSHLIVVSLFYGTASLTYLRPKSNQSPESKKLVSLSYTVITPMLNPIIYGLRNNEVKGA VKRTITQKVLQKLDVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF628 Human Gene Knockout Kit (CRISPR)
KN421166 1 Kit

ZNF628 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SensiStain™ Anti-Nanog Antibody
HY000187 0.1 mL

SensiStain™ Anti-Nanog Antibody

Sign In for Pricing
View Details
SuLT1A4 (NM_001017391) Human Over-expression Lysate
LC422772 20 µg

SuLT1A4 (NM_001017391) Human Over-expression Lysate

Sign In for Pricing
View Details
C3ORF31 (TAMM41) (NM_001284401) Human Tagged ORF Clone
RG237551 10 µg

C3ORF31 (TAMM41) (NM_001284401) Human Tagged ORF Clone

Sign In for Pricing
View Details
S-Nitroso-L-glutathione (>90%)
TRC-N527500-50MG 50 mg

S-Nitroso-L-glutathione (>90%)

Sign In for Pricing
View Details
Ezrin / p81 (CPTC-Ezrin-1), CF568 conjugate, 0.1mg/mL
BNC682238-500 1x 500 µL

Ezrin / p81 (CPTC-Ezrin-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details