Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 6 (Olfr6)

This Recombinant Mouse Olfactory receptor 6 (Olfr6) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 6, Odorant receptor M50, Olfactory receptor 103-16

UniProt

P34986

Expression Region

1-316

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENITNISEFILMGFPTAPWLQILLFSIFFITYVFVLLENLVIILTVWVTGSLHKPMYYF LSTMSFLEAWYISVTVPKMLAGFLFRPNTISFLGCMTQLYFFMSLACTECVLLAAMAYDR YVAICWPLRYPVMMTTGFCVQLTISSWVSGFTISMAKVYFISRVAFCGNNVLNHFFCDVS PILKLACMNLSMAETVDFALAIVILIFPLSATVLSYGFIVSTVLQIPSATGQRKAFSTCA SHLTVVVIFYTAVIFMYVRPRAIASFNSNKLISAIYAVFTPMLNPIIYCLRNKEVKDAIR KTIAGGRAPALGESIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis (1-chloro-2-propyl) phosphate-d12
HY-W653929 1 mg

Bis (1-chloro-2-propyl) phosphate-d12

Sign In for Pricing
View Details
CTNND1 (NM_001085459) Human Tagged ORF Clone
RG222825 10 µg

CTNND1 (NM_001085459) Human Tagged ORF Clone

Sign In for Pricing
View Details
TMP21 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-11262R-BF350 100 µL

TMP21 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Lentiviral human ALDH1A1 shRNA (UAS) - Lentiviral human ALDH1A1 shRNA (UAS) plasmid
GTR15114871 1 Vial

Lentiviral human ALDH1A1 shRNA (UAS) - Lentiviral human ALDH1A1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
MDH1B (NM_001039845) Human Over-expression Lysate
LS130752-20ug 20 µg

MDH1B (NM_001039845) Human Over-expression Lysate

Sign In for Pricing
View Details
Casein Kinase 1 alpha (CSNK1A1) (NM_001271741) Human Tagged ORF Clone
RC233767 10 µg

Casein Kinase 1 alpha (CSNK1A1) (NM_001271741) Human Tagged ORF Clone

Sign In for Pricing
View Details