Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4S1 (OR4S1)

This Recombinant Human Olfactory receptor 4S1 (OR4S1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 4S1, Olfactory receptor OR11-100

UniProt

Q8NGB4

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAKNNVTEFVLFGLFESREMQHTCFVVFFLFHVLTVLGNLLVIITINARKTLKSPMYFF LSQLSFADICYPSTTIPKMIADTFVEHKIISFNGCMTQLFSAHFFGGTEIFLLTAMAYDR YVAICRPLHYTAIMDCRKCGLLAGASWLAGFLHSILQTLLTVQLPFCGPNEIDNFFCDVH PLLKLACADTYMVGLIVVANSGMISLASFFILIISYVIILLNLRSQSSEDRRKAVSTCGS HVITVLLVLMPPMFMYIRPSTTLAADKLIILFNIVMPPLLNPLIYTLRNNDVKNAMRKLF RVKRSLGEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-conjugated beta actin Monoclonal Antibody
AN00295HP-01 25 µL

HRP-conjugated beta actin Monoclonal Antibody

Sign In for Pricing
View Details
HRP-conjugated beta actin Monoclonal Antibody
AN00295HP-02 100 µL

HRP-conjugated beta actin Monoclonal Antibody

Sign In for Pricing
View Details
Ethyl 3-Aminocrotonate
TRC-E898080-250G 250 g

Ethyl 3-Aminocrotonate

Sign In for Pricing
View Details
DOK1 (NM_001381) Human Over-expression Lysate
LY419987 100 µg

DOK1 (NM_001381) Human Over-expression Lysate

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Hydroxy PEG
1210000-0.1G 1 g

Ɑ-Methoxy-ω-Hydroxy PEG

Sign In for Pricing
View Details
Human THSD7A activation kit by CRISPRa
GA116653 1 Kit

Human THSD7A activation kit by CRISPRa

Sign In for Pricing
View Details