Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8U1 (OR8U1)

This Recombinant Human Olfactory receptor 8U1 (OR8U1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 8U1

UniProt

Q8NH10

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMY FFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMISESLLLASMAY DRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCD DMPLLRLTCSDTRFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFST CGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEA LKKIIINKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF11 Human Gene Knockout Kit (CRISPR)
KN208729RB 1 Kit

ARHGEF11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45 (PTPRC) (C-term) Rabbit Polyclonal Antibody
AP11621PU-N 400 µL

CD45 (PTPRC) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAFAH1B2 (NM_002572) Human Over-expression Lysate
LY419243 100 µg

PAFAH1B2 (NM_002572) Human Over-expression Lysate

Sign In for Pricing
View Details
QuantiFluo™ Glutaminase Assay Kit
DGLN-100 100 Tests

QuantiFluo™ Glutaminase Assay Kit

Sign In for Pricing
View Details
Sodium Dichromate Dihydrate
TRC-S615250-50G 50 g

Sodium Dichromate Dihydrate

Sign In for Pricing
View Details
JX 401
SIH-454-50MG 50 mg

JX 401

Sign In for Pricing
View Details