Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4K14 (OR4K14)

This Recombinant Human Olfactory receptor 4K14 (OR4K14) spans the amino acid sequence from region 1-310.

Product Specifications

Product Name Alternative

Olfactory receptor 4K14, Olfactory receptor OR14-22

UniProt

Q8NGD5

Expression Region

1-310

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQNYSLVSEFVLHGLCTSRHLQNFFFIFFFGVYVAIMLGNLLILVTVISDPCLHSSPM YFLLGNLAFLDMWLASFATPKMIRDFLSDQKLISFGGCMAQIFFLHFTGGAEMVLLVSMA YDRYVAICKPLHYMTLMSWQTCIRLVLASWVVGFVHSISQVAFTVNLPYCGPNEVDSFFC DLPLVIKLACMDTYVLGIIMISDSGLLSLSCFLLLLISYTVILLAIRQRAAGSTSKALST CSAHIMVVTLFFGPCIFVYVRPFSRFSVDKLLSVFYTIFTPLLNPIIYTLRNEEMKAAMK KLQNRRVTFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNA Rabbit Polyclonal Antibody
R1306-5 100 µL

PCNA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3’-Hydroxytyrosol 3’-Glucuronide
TRC-H977030-2.5MG 2.5 mg

3’-Hydroxytyrosol 3’-Glucuronide

Sign In for Pricing
View Details
SRPK1 Recombinant Rabbit Monoclonal Antibody [PSH08-26]
HA722970 100 µL

SRPK1 Recombinant Rabbit Monoclonal Antibody [PSH08-26]

Sign In for Pricing
View Details
HDAC3 Mouse Monoclonal Antibody [Clone ID: 3A7B5]
AM06268SU-N 100 µL

HDAC3 Mouse Monoclonal Antibody [Clone ID: 3A7B5]

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF740 conjugate, 0.1mg/mL
BNC741448-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF740 conjugate, 0.1mg/mL
BNC740900-100 1x 100 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details