Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4F3/4F16/4F29 (OR4F3)

This Recombinant Human Olfactory receptor 4F3/4F16/4F29 (OR4F3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 4F3/4F16/4F29, Olfactory receptor OR1-1

UniProt

Q6IEY1

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMY FLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAF DRYVALCKPLHYLTIMSPRMCLSFLAVAWTLGVSHSLFQLAFLVNLAFCGPNVLDSFYCD LPRLLRLACTDTYRLQFMVTVNSGFICVGTFFILLISYVFILFTVWKHSSGGSSKALSTL SAHSTVVLLFFGPPMFVYTRPHPNSQMDKFLAIFDAVLTPFLNPVVYTFRNKEMKAAIKR VCKQLVIYKRIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone receptor Rabbit Polyclonal Antibody
ER1901-96 100 µL

Progesterone receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Adnexa
CS710135 5x 5 µm

Tissue FFPE Sections, Adnexa

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody[4G7]
E-AB-F11270P-01 25 µg

Purified Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
Purified Anti-Human CD19 Antibody[4G7]
E-AB-F11270P-02 100 µg

Purified Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (121-3), CF647 conjugate, 0.1mg/mL
BNC470945-500 1x 500 µL

Double Stranded DNA (dsDNA) (121-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkbh7 Mouse Gene Knockout Kit (CRISPR)
KN501151 1 Kit

Alkbh7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details