Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8K3 (OR8K3)

This Recombinant Human Olfactory receptor 8K3 (OR8K3) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 8K3, Olfactory receptor OR11-181

UniProt

Q8NH51

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQHNLTTVNEFILTGITDIAELQAPLFALFLMIYVISVMGNLGMIVLTKLDSRLQTPMY FFLRHLAFMDLGYSTTVGPKMLVNFVVDKNIISYYFCATQLAFFLVFIGSELFILSAMSY DLYVAICNPLLYTVIMSRRVCQVLVAIPYLYCTFISLLVTIKIFTLSFCGYNVISHFYCD SLPLLPLLCSNTHEIELIILIFAAIDLISSLLIVLLSYLLILVAILRMNSAGRQKAFSTC GAHLTVVIVFYGTLLFMYVQPKSSHSFDTDKVASIFYTLVIPMLNPLIYSLRNKDVKYAL RRTWNNLCNIFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Myf5 activation kit by CRISPRa
GA202784 1 Kit

Mouse Myf5 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CCL11/Eotaxin Protein
PKSH032186-01 10 µg

Recombinant Human CCL11/Eotaxin Protein

Sign In for Pricing
View Details
Recombinant Human CCL11/Eotaxin Protein
PKSH032186-02 50 µg

Recombinant Human CCL11/Eotaxin Protein

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (KLK3/2871R), CF647 conjugate, 0.1mg/mL
BNC472871-500 1x 500 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PFKM (NM_000289) Human Over-expression Lysate
LY424822 100 µg

PFKM (NM_000289) Human Over-expression Lysate

Sign In for Pricing
View Details
Jag2 Mouse Gene Knockout Kit (CRISPR)
KN308538BN 1 Kit

Jag2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details