Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T12 (OR2T12)

This Recombinant Human Olfactory receptor 2T12 (OR2T12) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 2T12, Olfactory receptor OR1-57

UniProt

Q8NG77

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEMRNTTPDFILLGLFNHTRAHQVLFMMLLATVLTSLFSNALMILLIHWDHRLHRPMYFL LSQLSLMDMMLVSTTVPKMAADYLTGNKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDR YAAVCHPLRYPTLMSWQLCLRMTMSSWLLGAADGLLQAVATLSFPYCGAHEIDHFFCEAP VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLLMRSTEARKKAFATCS SHVAVVGLFYGAGIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVRNSEVKEALK RWLGTCVNLKHQQNEAHRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORA6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2212305 3x 1.0 µg

SNORA6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CIDE-B rabbit pAb
ES1983-01 50 µL

CIDE-B rabbit pAb

Sign In for Pricing
View Details
CIDE-B rabbit pAb
ES1983-02 100 µL

CIDE-B rabbit pAb

Sign In for Pricing
View Details
GATA Antibody
orb839621 2 mg

GATA Antibody

Sign In for Pricing
View Details
SLC22A25 (NM_199352) Human Tagged ORF Clone
RC223323 10 µg

SLC22A25 (NM_199352) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse Derlin-1 (Derl1)
orb2916961-01 20 µg

Recombinant Mouse Derlin-1 (Derl1)

Sign In for Pricing
View Details