Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Derlin-1 (Derl1)

This Recombinant Mouse Derlin-1 (Derl1) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Derlin-1, Degradation in endoplasmic reticulum protein 1, Der1-like protein 1

UniProt

Q99J56

Expression Region

1-251

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATF YFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLFNWICIVITGLAMDMQL LMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH NWGQGFRLGDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT13 (NM_052917) Human Over-expression Lysate
LC409395 20 µg

GALNT13 (NM_052917) Human Over-expression Lysate

Sign In for Pricing
View Details
Pstpip1 3'UTR GFP Stable Cell Line
TU267001 1.0 mL

Pstpip1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PTGES CRISPR Knock Out 293T Cell Line (Human)
38087141 1x 10^6 Cells / 1.0 mL

PTGES CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
InVivoMAb Anti-ZIKV Envelope protein E Antibody (Z23)
VVV31401 100 μg

InVivoMAb Anti-ZIKV Envelope protein E Antibody (Z23)

Sign In for Pricing
View Details
Tough-Spots, large, red labels for 1.5 mL and 2.0 mL tubes, 1/2 inch diameter, 1000/roll. For -196C to +80C.
9185-0504 1000 / Roll

Tough-Spots, large, red labels for 1.5 mL and 2.0 mL tubes, 1/2 inch diameter, 1000/roll. For -196C to +80C.

Sign In for Pricing
View Details
Synaptotagmin-15 (SYT15) Antibody
abx375768 100 µg

Synaptotagmin-15 (SYT15) Antibody

Sign In for Pricing
View Details