Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proto-oncogene Mas (Mas1)

This Recombinant Mouse Proto-oncogene Mas (Mas1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Proto-oncogene Mas

UniProt

P30554

Expression Region

1-324

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQSNMTSLAEEKAMNTSSRNASLGSSHPPIPIVHWVIMSISPLGFVENGILLWFLCFRM RRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHHYTIVTLSVTFLFGYNTGLY LLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVTTMEYVMCIDSGEESHSR SDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIFA MPMRVLYLLYYEYWSAFGNLHNISLLFSTINSSANPFIYFFVGSSKKKRFRESLKVVLTR AFKDEMQPRRQEGNGNTVSIETVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TBC1D10B sgRNA gene knockout kit - Lentiviral human TBC1D10B sgRNA gene knockout kit (25)
GTR15382788 1 Vial

Lentiviral human TBC1D10B sgRNA gene knockout kit - Lentiviral human TBC1D10B sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Cathepsin D and E FRET Substrate (acetate)
HY-P2498A-01 5 mg

Cathepsin D and E FRET Substrate (acetate)

Sign In for Pricing
View Details
Cathepsin D and E FRET Substrate (acetate)
HY-P2498A-02 10 mg

Cathepsin D and E FRET Substrate (acetate)

Sign In for Pricing
View Details
Cathepsin D and E FRET Substrate (acetate)
HY-P2498A-03 25 mg

Cathepsin D and E FRET Substrate (acetate)

Sign In for Pricing
View Details
Rabbit Anti-PRRSV M protein antibody
SL4506R-01 50 µL

Rabbit Anti-PRRSV M protein antibody

Sign In for Pricing
View Details
Rabbit Anti-PRRSV M protein antibody
SL4506R-02 100 µL

Rabbit Anti-PRRSV M protein antibody

Sign In for Pricing
View Details