Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-16 (srg-16)

This Recombinant Serpentine receptor class gamma-16 (srg-16) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-16, Protein srg-16

UniProt

O17819

Expression Region

1-325

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTSIRINCSKSYDDFVEASKFVGFCLYLIPGAILHVLILRILLIKQRKVFRNNSFFRIF ATDSVVSLVLIFWGIFFNRLFMFIPPLCPLVSPLFFEPSLFLKMYYWMYNHARMSKSVAQ ILMVLNRMCCVISPIGYEKIWNKLAVTTVFVVLALPFFGSWNLLLSRMYIFPSYGGFNAS YVKYVQWASLSMFQSIFLLIALCFTIICSSVSLYKLIILPDRIKSAEKSLCFVSLFYSIA FLVVAVSQLIFVFCEVCLKNRLYLLFQFFAFDFLTVGSAVIIMLSSPQLSNFLGFSGTFY RRKASPPGSTVVKIFTSVHNNSSII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAQ Mouse Monoclonal Antibody (HRP)
orb2610160 100 µg

GNAQ Mouse Monoclonal Antibody (HRP)

Sign In for Pricing
View Details
ZBTB20 (NM_001164346) Human Tagged ORF Clone Lentiviral Particle
RC228991L4V 200 µL

ZBTB20 (NM_001164346) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Scnn1g shRNA (UAS) - Lentiviral mouse Scnn1g shRNA (UAS, iRFP) (100)
GTR15218583 1 Vial

Lentiviral mouse Scnn1g shRNA (UAS) - Lentiviral mouse Scnn1g shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
PYCR2, ID (PYCR2, Pyrroline-5-carboxylate reductase 2) (Azide free) (HRP) discontinued
040707-HRP 200 µL

PYCR2, ID (PYCR2, Pyrroline-5-carboxylate reductase 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Homocysteine (Hcy) Elisa Kit
EKC37068 96 Tests

Mouse Homocysteine (Hcy) Elisa Kit

Sign In for Pricing
View Details
CCL22, Murine
2340-22-5-5μg 5 μg

CCL22, Murine

Sign In for Pricing
View Details