Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5D16 (OR5D16)

This Recombinant Human Olfactory receptor 5D16 (OR5D16) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Olfactory receptor 5D16, Olfactory receptor OR11-154

UniProt

Q8NGK9

Expression Region

1-328

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLTERNTTSEATFTLLGFSDYLELQIPLFFVFLAVYGFSVVGNLGMIVIIKINPKLHTP MYFFLNHLSFVDFCYSSIIAPMMLVNLVVEDRTISFSGCLVQFFFFCTFVVTELILFAVM AYDHFVAICNPLLYTVAISQKLCAMLVVVLYAWGVACSLTLACSALKLSFHGFNTINHFF CELSSLISLSYPDSYLSQLLLFTVATFNEISTLLIILTSYAFIIVTTLKMPSASGHRKVF STCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPLLNPLIYSLRNKDVK DAIRKIINTKYFHIKHRHWYPFNFVIEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRS2 (NM_006654) Human Over-expression Lysate
LC401989 20 µg

FRS2 (NM_006654) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Mpzl2 activation kit by CRISPRa
GA201312 1 Kit

Mouse Mpzl2 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene A FP
HA50056007.100G 100 g

Polystyrene A FP

Sign In for Pricing
View Details
SERPINB9 Rabbit Polyclonal Antibody
TA381384 100 µL

SERPINB9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZO-2 Antibody / Zonula occludens protein 2
RQ6808 100 µg

ZO-2 Antibody / Zonula occludens protein 2

Sign In for Pricing
View Details
Sirt6 Mouse Gene Knockout Kit (CRISPR)
KN515806 1 Kit

Sirt6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details