Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZO-2 Antibody / Zonula occludens protein 2

TJP2 (Tight Junction Protein 2), also known as Zona Occludens 2 or ZO2 is a protein that in humans is encoded by the TJP2 gene. Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. Duclos et al.(1994) mapped the TJP2 gene telomeric to the Friedreich ataxia critical region on chromosome 9q13-q21. TJP2 lies about 70 kb centromeric to the X123 gene and is transcribed in the centromere-to-telomere direction. Using in vitro assays and immunoprecipitation studies, Itoh et al.(1999) showed that the mouse Tjp1, Tjp2, and Tjp3 PDZ1 domains interacted with the C-terminal cytoplasmic domains of Cldn1 through Cldn8. In the mouse inner ear, Walsh et al.(2010) found that Tjp2 expression decreased rapidly between E16.5 and age 1 week to a level in adult mice that was approximately 50% of the level at birth(P0).

Product Specifications

CAS Number

9007-83-4

UniProt

Q9UDY2

Host

Rabbit

Immunogen

Amino acids KVKIFEKMDHKARLQRMQELQEAQNARIEIAQKH from the human protein were used as the immunogen for the Zonula occludens protein 2 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, IF

Format

Antigen affinity purified

Buffer

0.5mg/ml if reconstituted with 0.2ml sterile DI water

Reconstitution

After reconstitution, the Zonula occludens protein 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Zonula occludens protein 2 antibody is available for research use only.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (KRT10/844), CF568 conjugate, 0.1mg/mL
BNC680844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
mIgG1 Fcγ Fragment Specific Rabbit monoclonal antibody,clone OTIR8A7
TA592572 100 µL

mIgG1 Fcγ Fragment Specific Rabbit monoclonal antibody,clone OTIR8A7

Sign In for Pricing
View Details
Slc44a5 Mouse Gene Knockout Kit (CRISPR)
KN516127 1 Kit

Slc44a5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF488A conjugate, 0.1mg/mL
BNC881484-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL2 Antibody (HRP)
KH-895-01 50 μL

IL2 Antibody (HRP)

Sign In for Pricing
View Details
IL2 Antibody (HRP)
KH-895-02 100 µL

IL2 Antibody (HRP)

Sign In for Pricing
View Details