Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 33 (GPR33)

This Recombinant Human Probable G-protein coupled receptor 33 (GPR33) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 33

UniProt

Q49SQ1

Expression Region

1-333

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLINSTDYLINASTLVRNSTQFLAPASKMIIALSLYISSIIGTITNGLYLWVLRFKMKQ TVNTLLFFHLILSYFISTMILPFMATSQLQDNHWNFGTALCKVFNGTLSLGMFTSVFFLS AIGLDRYLLTLHPVWSQQHRTPRWASSIVLGVWISAAALSIPYLIFRETHHDRKGKVTCQ NNYAVSTNWESKEMQASRQWIHVACFISRFLLGFLLPFFIIIFCYERVASKVKERSLFKS SKPFKVMMTAIISFFVCWMPYHIHQGLLLTTNQSLLLELTLILTVLTTSFNTIFSPTLYL FVGENFKKVFKKSILALFESTFSEDSSVERTQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ces1g (NM_021456) Mouse Tagged ORF Clone
MR208931 10 µg

Ces1g (NM_021456) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MYO3B 3'UTR Luciferase Stable Cell Line
TU015086 1.0 mL

MYO3B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
hsa-miR-1587 Primers
MPH02226 150 µL - 10 µM

hsa-miR-1587 Primers

Sign In for Pricing
View Details
Human E6 protein
orb358154-01 20 µg

Human E6 protein

Sign In for Pricing
View Details
Human E6 protein
orb358154-02 100 µg

Human E6 protein

Sign In for Pricing
View Details
Human E6 protein
orb358154-03 1 mg

Human E6 protein

Sign In for Pricing
View Details