Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human E6 protein

This Human E6 protein spans the amino acid sequence from region 1-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E6, Protein E6

UniProt

P36814

Expression Region

1-148aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Human papillomavirus type 52

Field of Research

Cancer, Developmental Biology, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFEDPATRPRTLHELCEVLEESVHEIRLQCVQCKKELQRREVYKFLFTDLRIVYRDNNPYGVCIMCLRFLSKISEYRHYQYSLYGKTLEERVKKPLSEITIRCIICQTPLCPEEKERHVNANKRFHNIMGRWTGRCSECWRPRPVTQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKKβ (H-4) Alexa Fluor® 488
sc-8014 AF488 200 µg/mL

IKKβ (H-4) Alexa Fluor® 488

Sign In for Pricing
View Details
Recombinant Newcastle disease virus Nucleoprotein(N)
AP74224-01 20 µg

Recombinant Newcastle disease virus Nucleoprotein(N)

Sign In for Pricing
View Details
Recombinant Newcastle disease virus Nucleoprotein(N)
AP74224-02 100 µg

Recombinant Newcastle disease virus Nucleoprotein(N)

Sign In for Pricing
View Details
Recombinant Newcastle disease virus Nucleoprotein(N)
AP74224-03 1 mg

Recombinant Newcastle disease virus Nucleoprotein(N)

Sign In for Pricing
View Details
POGK Protein Vector (Mouse) (pPM-C-HA)
PV217668 500 ng

POGK Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FACT/SUPT16H Antibody
orb19521 100 µg

FACT/SUPT16H Antibody

Sign In for Pricing
View Details