Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 12 (Olfr12)

This Recombinant Mouse Olfactory receptor 12 (Olfr12) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Olfactory receptor 12, Odorant receptor M76

UniProt

Q60894

Expression Region

1-333

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATAVHRNGSLTPVSLRVFVLVGFGGGALTQALLFAVFLVLYVVTVLGNLTMIVVITLDA RLHSPMYFFLKNLSFVDLCYSSAIAPNALANFLSTSKVISFEACATQFFFFSLLATTETF LLAVMAYDRFMAICSPLRYPVTMCPTTCTRLVLGTFCVGCLNSIVQTSLTFQLPFCSSNR IDHFYCDVPPLLQLACASTALNELFLFGLCGFIIVSTTLAVLVSYGYITVTILRMHSGSG RHKVFSTCGSHLTAVSLFYGTLFVMYAQPGALTSMEQGKVVSIFYTLVIPMLNPLIYSLR NKDVKDALQRLGQRHSLVKAVRGCPAAGGNASV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCL Antibody
57-876 400 µL

NCL Antibody

Sign In for Pricing
View Details
Recombinant Human LOXL1 Protein, His-tagged
LOXL1-268H 10 µg

Recombinant Human LOXL1 Protein, His-tagged

Sign In for Pricing
View Details
ADCY5 Recombinant Protein
OPCD01120-10UG 10 µg

ADCY5 Recombinant Protein

Sign In for Pricing
View Details
Rabbit Monoclonal Complement Factor D/Adipsin Antibody (005) [DyLight 550]
NBP2-89302R 0.1 mL

Rabbit Monoclonal Complement Factor D/Adipsin Antibody (005) [DyLight 550]

Sign In for Pricing
View Details
C4ORF27 Antibody - middle region (ARP86694_P050)
ARP86694_P050 100 µL

C4ORF27 Antibody - middle region (ARP86694_P050)

Sign In for Pricing
View Details
Anti-ADAM28 Antibody Picoband® (APC Conjugate)
A06873-1-APC 100 µg/Vial

Anti-ADAM28 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details