Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class beta-6 (srb-6)

This Recombinant Serpentine receptor class beta-6 (srb-6) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Serpentine receptor class beta-6, Protein srb-6

UniProt

P54141

Expression Region

1-337

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDCDEVNNISYDPLYRYSQFYTLLTSIFSVFPLLYLIIFKLRVCTFNDNIKFLYIVYFT QILISVLNNCVVFAHHVVIPFLAVSKCDLLVNPVKNRIFQNIGVFGISCPMLTILGITAE RLLALIFARCYENVKLHIGVFIGVFAMLCDMALVYFFFLDEKFDQPSISYFMVPDTSGYK MNWLCYSLLAINSVNLVFNYFLVKINTILKEKWRNSLSTRYQMEENIITTKFSTFISFIH VFFFSLYLIFTLIIRLLGPGFLKTQADLMSVRGVYITIPTYNLIIGIASCVILRHLQRQK VAKVYAEVTLKYSGIDGAQIHQEAILNVWKTKSSGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1874906 1.0 µg DNA

RPL5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit polyclonal ERAB antibody
MBS5304833-01 0.05 mg

Rabbit polyclonal ERAB antibody

Sign In for Pricing
View Details
Rabbit polyclonal ERAB antibody
MBS5304833-02 5x 0.05 mg

Rabbit polyclonal ERAB antibody

Sign In for Pricing
View Details
ALDH1A2 (NM_003888) Human Recombinant Protein
TP323250L 1 mg

ALDH1A2 (NM_003888) Human Recombinant Protein

Sign In for Pricing
View Details
NCBP2 (NM_001042540) Human Recombinant Protein
PH34404M5 20 µg

NCBP2 (NM_001042540) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Rnf166 Pre-designed siRNA Set B
SI112093B 1 Each

Mouse Rnf166 Pre-designed siRNA Set B

Sign In for Pricing
View Details